Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA wax alcohol acyltransferase 2
LigandBDBM50433270
Substrate/Competitorn/a
Meas. Tech.ChEMBL_957771
IC50>100000±n/a nM
Citation Barlind, JGBuckett, LKCrosby, SGDavidsson, Emtenäs, HErtan, AJurva, ULemurell, MGutierrez, PMNilsson, KO'Mahony, GPetersson, AURedzic, AWågberg, FYuan, ZQ Identification and design of a novel series of MGAT2 inhibitors. Bioorg Med Chem Lett23:2721-6 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA wax alcohol acyltransferase 2
Name:Acyl-CoA wax alcohol acyltransferase 2
Synonyms:ARAT | AWAT2 | Acyl-CoA retinol O-fatty-acyltransferase | DC4 | DGAT2L4 | Diacylglycerol O-acyltransferase 2-like protein 4 | Diacylglycerol O-acyltransferase candidate 4 | Long-chain-alcohol O-fatty-acyltransferase 2 | MFAT | Multifunctional O-acyltransferase | Retinol O-fatty-acyltransferase | WS | Wax synthase | hDC4 | hWS
Type:PROTEIN
Mol. Mass.:38111.73
Organism:Homo sapiens (Human)
Description:ChEMBL_107584
Residue:333
Sequence:
MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW
KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF
ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV
IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG
FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV
AKYHTLYIDALRKLFDQHKTKFGISETQELEII
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433270
NameBDBM50433270
Synonyms:CHEMBL2376329
TypeSmall organic molecule
Emp. Form.C19H21N3O5S
Mol. Mass.403.452
SMILESCCC1(C)NC(=O)c2cc(ccc2NC1=O)S(=O)(=O)Nc1ccc(OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a