Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucagon receptor
LigandBDBM50433594
Substrate/Competitorn/a
Meas. Tech.ChEMBL_960258
Ki 220±n/a nM
Citation Guzman-Perez, APfefferkorn, JALee, ECStevens, BDAspnes, GEBian, JDidiuk, MTFilipski, KJMoore, DPerreault, CSammons, MFTu, MBrown, JAtkinson, KLitchfield, JTan, BSamas, BZavadoski, WJSalatto, CTTreadway, J The design and synthesis of a potent glucagon receptor antagonist with favorable physicochemical and pharmacokinetic properties as a candidate for the treatment of type 2 diabetes mellitus. Bioorg Med Chem Lett23:3051-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucagon receptor
Name:Glucagon receptor
Synonyms:GL-R | Glucagon Receptor (GCGR) | Glucagon receptor (GlucR)
Type:Enzyme
Mol. Mass.:54026.92
Organism:Homo sapiens (Human)
Description:P47871
Residue:477
Sequence:
MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ
CQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANL
FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC
WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV
HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433594
NameBDBM50433594
Synonyms:CHEMBL2381828
TypeSmall organic molecule
Emp. Form.C24H24F3N3O4
Mol. Mass.475.4603
SMILESCCCC(Oc1ccc(cc1)-n1cnc(c1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a