Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50433877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_959635
Ki 11±n/a nM
Citation Jin, YRoycik, MDBosco, DBCao, QConstantino, MHSchwartz, MASang, QX Matrix metalloproteinase inhibitors based on the 3-mercaptopyrrolidine core. J Med Chem56:4357-73 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433877
NameBDBM50433877
Synonyms:CHEMBL2380390
TypeSmall organic molecule
Emp. Form.C34H44N4O5S2
Mol. Mass.652.867
SMILESCNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](CC(C)C)S[C@H]1CN(C[C@H]1S)C(=O)CCCCCN1C(=O)c2ccccc2C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a