Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivin receptor-like kinase 3 (ALK-3)
LigandBDBM50434749
Substrate/Competitorn/a
Meas. Tech.ChEMBL_961934
IC50 55±n/a nM
Citation Engers, DWFrist, AYLindsley, CWHong, CCHopkins, CR Synthesis and structure-activity relationships of a novel and selective bone morphogenetic protein receptor (BMP) inhibitor derived from the pyrazolo[1.5-a]pyrimidine scaffold of dorsomorphin: the discovery of ML347 as an ALK2 versus ALK3 selective MLPCN probe. Bioorg Med Chem Lett23:3248-52 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activin receptor-like kinase 3 (ALK-3)
Name:Activin receptor-like kinase 3 (ALK-3)
Synonyms:BMPR1A | Bone morphogenetic protein receptor type-1A
Type:Enzyme
Mol. Mass.:60204.46
Organism:Homo sapiens (Human)
Description:P36894
Residue:532
Sequence:
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50434749
NameBDBM50434749
Synonyms:CHEMBL2385586
TypeSmall organic molecule
Emp. Form.C19H19N7
Mol. Mass.345.4011
SMILESC1CN(CCN1)c1ccc(cc1)-c1cnc2c(cnn2c1)-c1cn[nH]c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a