Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase subunit beta-1
LigandBDBM50262685
Substrate/Competitorn/a
Meas. Tech.ChEMBL_961928
IC50 235±n/a nM
Citation Engers, DWFrist, AYLindsley, CWHong, CCHopkins, CR Synthesis and structure-activity relationships of a novel and selective bone morphogenetic protein receptor (BMP) inhibitor derived from the pyrazolo[1.5-a]pyrimidine scaffold of dorsomorphin: the discovery of ML347 as an ALK2 versus ALK3 selective MLPCN probe. Bioorg Med Chem Lett23:3248-52 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase subunit beta-1
Name:5'-AMP-activated protein kinase subunit beta-1
Synonyms:5'-AMP-activated protein kinase subunit beta-1 (AMPK) | 5''''''''-AMP-activated protein kinase subunit beta-1 | 5''''-AMP-activated protein kinase catalytic subunit alpha-2/beta-1/gamma-2 | 5''''-AMP-activated protein kinase subunit beta-1 | 5''-AMP-activated protein kinase subunit beta-1 | AMP-activated protein kinase, beta-1 subunit | AMPK | AMPK subunit beta-1 | AMPKb | PRKAB1
Type:n/a
Mol. Mass.:30380.94
Organism:Homo sapiens (Human)
Description:Q9Y478
Residue:270
Sequence:
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50262685
NameBDBM50262685
Synonyms:6-(4-(2-(piperidin-1-yl)ethoxy)phenyl)-3-(pyridin-4-yl)pyrazolo[1,5-a]pyrimidine | 6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine | CHEMBL478629 | Dorsomorphin | US9040694, Dorsomorphin
TypeSmall organic molecule
Emp. Form.C24H25N5O
Mol. Mass.399.4882
SMILESC(CN1CCCCC1)Oc1ccc(cc1)-c1cnc2c(cnn2c1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a