Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase 23 (VHZ)
LigandBDBM50436358
Substrate/Competitorn/a
Meas. Tech.ChEMBL_966891
IC50 3400±n/a nM
Citation He, YLiu, SMenon, AStanford, SOppong, EGunawan, AMWu, LWu, DJBarrios, AMBottini, NCato, ACZhang, ZY A potent and selective small-molecule inhibitor for the lymphoid-specific tyrosine phosphatase (LYP), a target associated with autoimmune diseases. J Med Chem56:4990-5008 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein phosphatase 23 (VHZ)
Name:Dual specificity protein phosphatase 23 (VHZ)
Synonyms:DUSP23 | Dual specificity protein phosphatase 23 | LDP-3 | LDP3 | Low molecular mass dual specificity phosphatase 3 | VH1-like phosphatase Z | VHZ
Type:Enzyme
Mol. Mass.:16592.49
Organism:Homo sapiens (Human)
Description:Q9BVJ7
Residue:150
Sequence:
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50436358
NameBDBM50436358
Synonyms:CHEMBL2396718
TypeSmall organic molecule
Emp. Form.C28H22ClNO6
Mol. Mass.503.93
SMILESCCCNC(=O)COc1ccc(cc1)-c1oc2cc(O)c(cc2c1C#Cc1cccc(Cl)c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a