Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM50436682
Substrate/Competitorn/a
Meas. Tech.ChEMBL_967970
Ki 0.440000±n/a nM
Citation Zhao, YYu, SSun, WLiu, LLu, JMcEachern, DShargary, SBernard, DLi, XZhao, TZou, PSun, DWang, S A potent small-molecule inhibitor of the MDM2-p53 interaction (MI-888) achieved complete and durable tumor regression in mice. J Med Chem56:5553-61 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50436682
NameBDBM50436682
Synonyms:CHEMBL2396674
TypeSmall organic molecule
Emp. Form.C28H32Cl2FN3O3
Mol. Mass.548.476
SMILESCC(C)(C)C[C@@H]1N[C@H]([C@H](c2cccc(Cl)c2F)[C@]11C(=O)Nc2cc(Cl)ccc12)C(=O)N[C@H]1C[C@@](C)(O)C1 |r,wU:33.38,17.19,8.8,31.34,5.4,wD:33.37,7.31,(42.41,-31.09,;41.21,-30.13,;41.45,-28.61,;42.69,-29.73,;39.78,-30.69,;38.58,-29.72,;38.65,-28.19,;37.21,-27.64,;36.25,-28.84,;34.91,-28.07,;33.58,-28.84,;32.23,-28.08,;32.23,-26.52,;33.57,-25.75,;33.56,-24.21,;34.91,-26.52,;34.9,-24.97,;37.09,-30.13,;38,-31.39,;39.54,-31.39,;37.09,-32.64,;35.61,-32.16,;34.28,-32.93,;32.95,-32.16,;31.61,-32.93,;32.95,-30.62,;34.28,-29.85,;35.61,-30.61,;37.21,-26.1,;35.88,-25.33,;38.55,-25.33,;40.09,-25.32,;41.18,-24.24,;42.26,-25.32,;43.59,-24.55,;43.6,-26.09,;41.19,-26.42,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a