Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM50436688
Substrate/Competitorn/a
Meas. Tech.ChEMBL_967970
Ki 0.610000±n/a nM
Citation Zhao, YYu, SSun, WLiu, LLu, JMcEachern, DShargary, SBernard, DLi, XZhao, TZou, PSun, DWang, S A potent small-molecule inhibitor of the MDM2-p53 interaction (MI-888) achieved complete and durable tumor regression in mice. J Med Chem56:5553-61 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50436688
NameBDBM50436688
Synonyms:CHEMBL2398473
TypeSmall organic molecule
Emp. Form.C27H30Cl2FN3O3
Mol. Mass.534.45
SMILESCC(C)(C)C[C@@H]1N[C@H]([C@H](c2cccc(Cl)c2F)[C@]11C(=O)Nc2cc(Cl)ccc12)C(=O)N[C@H]1C[C@H](O)C1 |r,wU:17.19,8.8,31.34,5.4,wD:7.31,33.37,(42.17,-8.02,;40.97,-7.05,;41.2,-5.53,;42.45,-6.65,;39.53,-7.61,;38.33,-6.65,;38.41,-5.11,;36.97,-4.56,;36.01,-5.76,;34.66,-4.99,;33.33,-5.77,;31.99,-5.01,;31.98,-3.45,;33.32,-2.67,;33.32,-1.13,;34.66,-3.44,;34.66,-1.9,;36.85,-7.05,;37.76,-8.31,;39.3,-8.31,;36.85,-9.57,;35.37,-9.09,;34.04,-9.86,;32.71,-9.09,;31.37,-9.86,;32.71,-7.54,;34.04,-6.77,;35.37,-7.54,;36.97,-3.02,;35.64,-2.25,;38.31,-2.26,;39.64,-3.03,;41.12,-2.65,;41.52,-4.14,;42.85,-4.91,;40.03,-4.53,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a