Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-carbonic anhydrase
LigandBDBM26981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_972118
Ki 160000000±n/a nM
Citation Del Prete, SVullo, DDe Luca, VCarginale, VScozzafava, ASupuran, CTCapasso, C A highly catalytically activeż-carbonic anhydrase from the pathogenic anaerobe Porphyromonas gingivalis and its inhibition profile with anions and small molecules. Bioorg Med Chem Lett23:4067-71 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-carbonic anhydrase
Name:Gamma-carbonic anhydrase
Synonyms:CAM | Carbonic anhydrase
Type:Protein
Mol. Mass.:26390.56
Organism:Methanosarcina thermophila
Description:P40881
Residue:247
Sequence:
MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26981
NameBDBM26981
Synonyms:CHEMBL1644695 | CHEMBL185537 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
TypeIon
Emp. Form.I
Mol. Mass.126.90502
SMILES[I-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a