Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethionine aminopeptidase 2
LigandBDBM64987
Substrate/Competitorn/a
Meas. Tech.ChEMBL_972463
IC50 55±n/a nM
Citation Wangtrakuldee, PByrd, MSCampos, CGHenderson, MWZhang, ZClare, MMasoudi, AMyler, PJHorn, JRCotter, PAHagen, TJ Discovery of Inhibitors of ACS Med Chem Lett4:699-703 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Methionine aminopeptidase 2
Name:Aminopeptidase
Synonyms:Initiation factor 2-associated 67 kDa glycoprotein | MAP 2 | MetAP 2 | Methionine aminopeptidase 2 (MetAP2) | Methionine aminopeptidases (HsMetAP2) | Peptidase M 2 | p67 | p67eIF2
Type:Enzyme
Mol. Mass.:52884.45
Organism:Homo sapiens (Human)
Description:n/a
Residue:478
Sequence:
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM64987
NameBDBM64987
Synonyms:5-nitro-8-quinolinol | 5-nitroquinolin-8-ol | 8-HYDROXY-5-NITROQUINOLINE | MLS000069750 | SMR000059036 | cid_19910 | nitroxoline
TypeSmall organic molecule
Emp. Form.C9H6N2O3
Mol. Mass.190.1555
SMILESOc1ccc([N+]([O-])=O)c2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a