Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose 5-phosphate reductoisomerase
LigandBDBM50437797
Substrate/Competitorn/a
Meas. Tech.ChEMBL_973766
IC50 320±n/a nM
Citation Jansson, AMWieckowska, ABjörkelid, CYahiaoui, SSooriyaarachchi, SLindh, MBergfors, TDharavath, SDesroses, MSuresh, SAndaloussi, MNikhil, RSreevalli, SSrinivasa, BRLarhed, MJones, TAKarlén, AMowbray, SL DXR inhibition by potent mono- and disubstituted fosmidomycin analogues. J Med Chem56:6190-9 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Name:1-deoxy-D-xylulose 5-phosphate reductoisomerase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42846.92
Organism:Mycobacterium tuberculosis
Description:ChEMBL_1474510
Residue:413
Sequence:
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437797
NameBDBM50437797
Synonyms:CHEMBL2407184
TypeSmall organic molecule
Emp. Form.C16H16Cl2NO5P
Mol. Mass.404.182
SMILESON(CCC(c1ccc(Cl)c(Cl)c1)P(O)(O)=O)C(=O)c1ccccc1
Structure
n/a