Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein 14
LigandBDBM33437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_973067
pH8±n/a
IC50>30000±n/a nM
Commentsextracted
Citation Tan, XFurio, LReboud-Ravaux, MVilloutreix, BOHovnanian, AEl Amri, C 1,2,4-Triazole derivatives as transient inactivators of kallikreins involved in skin diseases. Bioorg Med Chem Lett23:4547-51 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein 14
Name:Kallikrein 14
Synonyms:KLK-L6 | Kallikrein-14 | Kallikrein-like protein 6 | hK14
Type:PROTEIN
Mol. Mass.:29136.99
Organism:Homo sapiens
Description:ChEMBL_1282452
Residue:267
Sequence:
MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA
GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN
SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC
VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER
CALPGYPGVYTNLCKYRSWIEETMRDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33437
NameBDBM33437
Synonyms:(5-amino-3-phenyl-1,2,4-triazol-1-yl)-(3,4-dimethoxyphenyl)methanone | (5-azanyl-3-phenyl-1,2,4-triazol-1-yl)-(3,4-dimethoxyphenyl)methanone | 1-(3,4-dimethoxybenzoyl)-3-phenyl-1H-1,2,4-triazol-5-amine | MLS000099650 | SMR000074479 | cid_975107
TypeSmall organic molecule
Emp. Form.C17H16N4O3
Mol. Mass.324.3339
SMILESCOc1ccc(cc1OC)C(=O)n1nc(nc1N)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a