Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein 14
LigandBDBM33882
Substrate/Competitorn/a
Meas. Tech.ChEMBL_973067
pH8±n/a
IC50>30000±n/a nM
Commentsextracted
Citation Tan, XFurio, LReboud-Ravaux, MVilloutreix, BOHovnanian, AEl Amri, C 1,2,4-Triazole derivatives as transient inactivators of kallikreins involved in skin diseases. Bioorg Med Chem Lett23:4547-51 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein 14
Name:Kallikrein 14
Synonyms:KLK-L6 | Kallikrein-14 | Kallikrein-like protein 6 | hK14
Type:PROTEIN
Mol. Mass.:29136.99
Organism:Homo sapiens
Description:ChEMBL_1282452
Residue:267
Sequence:
MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA
GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN
SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC
VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER
CALPGYPGVYTNLCKYRSWIEETMRDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33882
NameBDBM33882
Synonyms:(5-amino-3-pyridin-3-yl-1,2,4-triazol-1-yl)-(4-chlorophenyl)methanone | (5-azanyl-3-pyridin-3-yl-1,2,4-triazol-1-yl)-(4-chlorophenyl)methanone | 1-(4-chlorobenzoyl)-3-pyridin-3-yl-1H-1,2,4-triazol-5-amine | MLS000727811 | SMR000306508 | [5-amino-3-(3-pyridinyl)-1,2,4-triazol-1-yl]-(4-chlorophenyl)methanone | [5-amino-3-(3-pyridyl)-1,2,4-triazol-1-yl]-(4-chlorophenyl)methanone | cid_5000438
TypeSmall organic molecule
Emp. Form.C14H10ClN5O
Mol. Mass.299.715
SMILESNc1nc(nn1C(=O)c1ccc(Cl)cc1)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a