Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylpolyamine amidohydrolase (APAH)
LigandBDBM50438389
Substrate/Competitorn/a
Meas. Tech.ChEMBL_975718
IC50 39000±n/a nM
Citation Decroos, CBowman, CMChristianson, DW Synthesis and evaluation of N8-acetylspermidine analogues as inhibitors of bacterial acetylpolyamine amidohydrolase. Bioorg Med Chem21:4530-40 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylpolyamine amidohydrolase (APAH)
Name:Acetylpolyamine amidohydrolase (APAH)
Synonyms:Acetylpolyamine aminohydrolase
Type:Protein
Mol. Mass.:36324.64
Organism:Mycoplana ramosa (Gram-negative bacterium)
Description:n/a
Residue:341
Sequence:
MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVL
KVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAI
SPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQR
LLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAG
AGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPD
YITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50438389
NameBDBM50438389
Synonyms:CHEMBL2414001
TypeSmall organic molecule
Emp. Form.C12H24N2O2S
Mol. Mass.260.396
SMILESCC(=O)SCC(=O)CCCCCNCCCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a