Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeoxycytidine kinase
LigandBDBM50440144
Substrate/Competitorn/a
Meas. Tech.ChEMBL_981695
IC50 2381±n/a nM
Citation Murphy, JMArmijo, ALNomme, JLee, CHSmith, QALi, ZCampbell, DOLiao, HINathanson, DAAustin, WRLee, JTDarvish, RWei, LWang, JSu, YDamoiseaux, RSadeghi, SPhelps, MEHerschman, HRCzernin, JAlexandrova, ANJung, MELavie, ARadu, CG Development of new deoxycytidine kinase inhibitors and noninvasive in vivo evaluation using positron emission tomography. J Med Chem56:6696-708 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Deoxycytidine kinase
Name:Deoxycytidine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30361.42
Organism:Mus musculus
Description:ChEMBL_981695
Residue:260
Sequence:
MATPPKRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQASEDWEVVPEPVARWCN
VQSTQEEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTSFDYLQEVPVLTLDVNE
DFKDKHESLVEKVKEFLSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440144
NameBDBM50440144
Synonyms:CHEMBL2426584
TypeSmall organic molecule
Emp. Form.C17H18FN5OS2
Mol. Mass.391.486
SMILESCc1ccc(cc1OCCF)-c1nc(CSc2nc(N)cc(N)n2)cs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a