Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHomo sapiens lysine demethylase 2A (KDM2A)
LigandBDBM50324535
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982479
IC50 200±n/a nM
Citation Suzuki, TOzasa, HItoh, YZhan, PSawada, HMino, KWalport, LOhkubo, RKawamura, AYonezawa, MTsukada, YTumber, ANakagawa, HHasegawa, MSasaki, RMizukami, TSchofield, CJMiyata, N Identification of the KDM2/7 histone lysine demethylase subfamily inhibitor and its antiproliferative activity. J Med Chem56:7222-31 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Homo sapiens lysine demethylase 2A (KDM2A)
Name:Homo sapiens lysine demethylase 2A (KDM2A)
Synonyms:AA1-1162 | F-box and leucine-rich repeat protein 11 | FBXL11 | Lysine-specific demethylase 2A | Lysine-specific demethylase 2A (KDM2A) | NM_012308
Type:Enzyme Catalytic Domain
Mol. Mass.:132809.04
Organism:Homo sapiens (Human)
Description:n/a
Residue:1162
Sequence:
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50324535
NameBDBM50324535
Synonyms:3-{[9-(Dimethylamino)nonanoyl](hydroxy)amino}propanoicAcid Hydrochloride | CHEMBL1215519 | CHEMBL1229308
TypeSmall organic molecule
Emp. Form.C14H28N2O4
Mol. Mass.288.3831
SMILESCN(C)CCCCCCCCC(=O)N(O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a