Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4C (KDM4C)
LigandBDBM50324535
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982484
IC50 2200±n/a nM
Citation Suzuki, TOzasa, HItoh, YZhan, PSawada, HMino, KWalport, LOhkubo, RKawamura, AYonezawa, MTsukada, YTumber, ANakagawa, HHasegawa, MSasaki, RMizukami, TSchofield, CJMiyata, N Identification of the KDM2/7 histone lysine demethylase subfamily inhibitor and its antiproliferative activity. J Med Chem56:7222-31 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4C (KDM4C)
Name:Lysine-specific demethylase 4C (KDM4C)
Synonyms:Lysine-specific demethylase 4C
Type:Protein
Mol. Mass.:119979.01
Organism:Homo sapiens (Human)
Description:Q9H3R0
Residue:1056
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50324535
n/a
NameBDBM50324535
Synonyms:3-{[9-(Dimethylamino)nonanoyl](hydroxy)amino}propanoicAcid Hydrochloride | CHEMBL1215519 | CHEMBL1229308
TypeSmall organic molecule
Emp. Form.C14H28N2O4
Mol. Mass.288.3831
SMILESCN(C)CCCCCCCCC(=O)N(O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: