Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4A (KDM4A)
LigandBDBM50440286
Substrate/Competitorn/a
Meas. Tech.ChEMBL_982483
IC50 99000±n/a nM
Citation Suzuki, TOzasa, HItoh, YZhan, PSawada, HMino, KWalport, LOhkubo, RKawamura, AYonezawa, MTsukada, YTumber, ANakagawa, HHasegawa, MSasaki, RMizukami, TSchofield, CJMiyata, N Identification of the KDM2/7 histone lysine demethylase subfamily inhibitor and its antiproliferative activity. J Med Chem56:7222-31 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4A (KDM4A)
Name:Lysine-specific demethylase 4A
Synonyms:JmjC domain-containing histone demethylation protein 3A | Jumonji domain-containing protein 2A | Lysine-specific demethylase 4A
Type:Enzyme
Mol. Mass.:120647.83
Organism:Homo sapiens (Human)
Description:O75164
Residue:1064
Sequence:
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELP
PRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEE
QAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTG
VLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPL
SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNET
MAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI
NLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSL
RGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSIT
AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEG
EVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSV
ASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440286
n/a
NameBDBM50440286
Synonyms:CHEMBL2424815
TypeSmall organic molecule
Emp. Form.C19H35NO4
Mol. Mass.341.4855
SMILESON(CCC(O)=O)C(=O)CCCCCCCCC1CCCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: