Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 2
LigandBDBM50441521
Substrate/Competitorn/a
Meas. Tech.ChEMBL_988475
IC50 23±n/a nM
Citation Perspicace, EGiorgio, ACarotti, AMarchais-Oberwinkler, SHartmann, RW Novel N-methylsulfonamide and retro-N-methylsulfonamide derivatives as 17-hydroxysteroid dehydrogenase type 2 (17-HSD2) inhibitors with good ADME-related physicochemical parameters. Eur J Med Chem69:201-15 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 2
Name:Estradiol 17-beta-dehydrogenase 2
Synonyms:17-beta-Hydroxysteroid Dehydrogenase 2 (17-beta-HSD2) | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | Estradiol 17-beta-dehydrogenase 2 (17beta-HSD2) | Microsomal 17-beta-hydroxysteroid dehydrogenas | Testosterone 17-beta-dehydrogenase
Type:Oxidoreductase; single-pass type II membrane protein
Mol. Mass.:42795.29
Organism:Homo sapiens (Human)
Description:Enzyme was partially purified from human placenta.
Residue:387
Sequence:
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50441521
NameBDBM50441521
Synonyms:CHEMBL2436731
TypeSmall organic molecule
Emp. Form.C19H16FNO4S
Mol. Mass.373.398
SMILESCN(c1cccc(c1)-c1cccc(O)c1)S(=O)(=O)c1ccc(F)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a