Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene A4 hydrolase
LigandBDBM50441910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_987635
Ki 643±n/a nM
Citation Ali, AREl-Bendary, ERGhaly, MAShehata, IA Novel acetamidothiazole derivatives: synthesis and in vitro anticancer evaluation. Eur J Med Chem69:908-19 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene A4 hydrolase
Name:Leukotriene A4 hydrolase
Synonyms:LTA-4 hydrolase | Leukotriene A(4) hydrolase | Leukotriene A-4 hydrolase (LTA4H)
Type:Hydrolase; metalloprotease
Mol. Mass.:69280.41
Organism:Homo sapiens (Human)
Description:Human recombinant LTA4H.
Residue:611
Sequence:
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50441910
NameBDBM50441910
Synonyms:CHEMBL2437293
TypeSmall organic molecule
Emp. Form.C21H22N4OS
Mol. Mass.378.491
SMILESN=c1scc(-c2ccccc2)n1CC(=O)N1CCN(CC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a