Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytohesin-2
LigandBDBM50441973
Substrate/Competitorn/a
Meas. Tech.ChEMBL_992400
Ki 1610000±n/a nM
Citation Rouhana, JHoh, FEstaran, SHenriquet, CBoublik, YKerkour, ATrouillard, RMartinez, JPugnière, MPadilla, AChavanieu, A Fragment-based identification of a locus in the Sec7 domain of Arno for the design of protein-protein interaction inhibitors. J Med Chem56:8497-511 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytohesin-2
Name:Cytohesin-2
Synonyms:ARF exchange factor | ARF nucleotide-binding site opener | ARNO | CYTH2 | PH, SEC7 and coiled-coil domain-containing protein 2 | PSCD2 | PSCD2L | Protein ARNO
Type:PROTEIN
Mol. Mass.:46539.02
Organism:Homo sapiens (Human)
Description:ChEMBL_102649
Residue:400
Sequence:
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50441973
NameBDBM50441973
Synonyms:CHEMBL2440218
TypeSmall organic molecule
Emp. Form.C15H17NO4S
Mol. Mass.307.365
SMILESCOc1ccc(cc1)S(=O)(=O)Nc1c(C)cc(O)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a