Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEukaryotic elongation factor 2 kinase
LigandBDBM50442760
Substrate/Competitorn/a
Meas. Tech.ChEMBL_989483
IC50>10.0±n/a nM
Citation Brasca, MGMantegani, SAmboldi, NBindi, SCaronni, DCasale, ECeccarelli, WColombo, NDe Ponti, ADonati, DErmoli, AFachin, GFelder, ERFerguson, RDFiorelli, CGuanci, MIsacchi, APesenti, EPolucci, PRiceputi, LSola, FVisco, CZuccotto, FFogliatto, G Discovery of NMS-E973 as novel, selective and potent inhibitor of heat shock protein 90 (Hsp90). Bioorg Med Chem21:7047-63 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Eukaryotic elongation factor 2 kinase
Name:Eukaryotic elongation factor 2 kinase
Synonyms:Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase | EEF2K | Eukaryotic elongation factor 2 kinase (EEF2K) | Eukaryotic elongation factor 2 kinase (eEF-2K) | eEF-2 kinase | eEF-2K
Type:Protein
Mol. Mass.:82116.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:725
Sequence:
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442760
NameBDBM50442760
Synonyms:CHEMBL2443044
TypeSmall organic molecule
Emp. Form.C22H22N4O7
Mol. Mass.454.4327
SMILESCN1CCC(CC1)NC(=O)c1cc(on1)-c1c(O)cc(O)cc1Oc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a