Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 7 (CDK7)
LigandBDBM50425002
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1274640
Ki 1870±n/a nM
Citation Shao, HShi, SFoley, DWLam, FAbbas, AYLiu, XHuang, SJiang, XBaharin, NFischer, PMWang, S Synthesis, structure-activity relationship and biological evaluation of 2,4,5-trisubstituted pyrimidine CDK inhibitors as potential anti-tumour agents. Eur J Med Chem70:447-55 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 7 (CDK7)
Name:Cyclin-Dependent Kinase 7 (CDK7)
Synonyms:CDK-activating kinase assembly factor MAT1/Cyclin H/Cyclin-dependent kinase 7 | CDK7/Cyclin H | Cyclin H/dependent kinase 7 | Cyclin-dependent kinase 7/ cyclin H | Cyclin-dependent kinase 7/cyclin H
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:CDK7/Cyclin H/MNAT1
Synonyms:Cyclin H | Cyclin-H | MO15-associated protein | p34 | p37
Type:Enzyme Subunit
Mol. Mass.:37646.05
Organism:Homo sapiens (human)
Description:n/a
Residue:323
Sequence:
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:CDK7/Cyclin H/MNAT1
Synonyms:39 kDa protein kinase | CAK1 | CDK-activating kinase | CDK-activating kinase 1 (CAK) | CDK7 | Cell division protein kinase 7 | Cyclin-Dependent Kinase 7 (CDK7) | Cyclin-dependent kinase 7 | Cyclin-dependent kinase 7 (CDK7/cyclin H) | P39 Mo15 | STK1 | TFIIH basal transcription factor complex kinase subunit
Type:Enzyme Subunit
Mol. Mass.:39047.01
Organism:Homo sapiens (human)
Description:n/a
Residue:346
Sequence:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50425002
NameBDBM50425002
Synonyms:CHEMBL2312191
TypeSmall organic molecule
Emp. Form.C21H21N7O2S
Mol. Mass.435.502
SMILESCNc1nc(C)c(s1)-c1nc(Nc2cccc(c2)C(=O)N2CCOCC2)ncc1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a