Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50443544
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1278926
IC50 4.0±n/a nM
Citation Truax, VMZhao, HKatzman, BMProsser, ARAlcaraz, AASaindane, MTHoward, RBCulver, DArrendale, RFGruddanti, PREvers, TJNatchus, MGSnyder, JPLiotta, DCWilson, LJ Discovery of tetrahydroisoquinoline-based CXCR4 antagonists. ACS Med Chem Lett4:1025-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50443544
NameBDBM50443544
Synonyms:CHEMBL3091684
TypeSmall organic molecule
Emp. Form.C25H34N4O
Mol. Mass.406.5637
SMILESCC(=O)NCCCCN(C[C@H]1Cc2ccccc2CN1)[C@H]1CCCc2cccnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a