Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast activation protein alpha
LigandBDBM50443754
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1279907
IC50 140±n/a nM
Citation Wang, JFeng, YJi, XDeng, GLeng, YLiu, H Synthesis and biological evaluation of pyrrolidine-2-carbonitrile and 4-fluoropyrrolidine-2-carbonitrile derivatives as dipeptidyl peptidase-4 inhibitors for the treatment of type 2 diabetes. Bioorg Med Chem21:7418-29 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast activation protein alpha
Name:Fibroblast activation protein alpha
Synonyms:170 kDa melanoma membrane-bound gelatinase | Integral membrane serine protease | Seprase
Type:Enzyme
Mol. Mass.:87712.48
Organism:Homo sapiens (Human)
Description:Q12884
Residue:760
Sequence:
MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50443754
NameBDBM50443754
Synonyms:CHEMBL3093905
TypeSmall organic molecule
Emp. Form.C15H18FN3O2
Mol. Mass.291.3207
SMILESCOc1ccc(C[C@H](N)C(=O)N2C[C@@H](F)C[C@H]2C#N)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a