Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50444695
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1281646
IC50 4000±n/a nM
Citation Ottanà, RMaccari, RMortier, JCaselli, AAmuso, SCamici, GRotondo, AWolber, GPaoli, P Synthesis, biological activity and structure-activity relationships of new benzoic acid-based protein tyrosine phosphatase inhibitors endowed with insulinomimetic effects in mouse C2C12 skeletal muscle cells. Eur J Med Chem71:112-27 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50444695
NameBDBM50444695
Synonyms:CHEMBL3098852
TypeSmall organic molecule
Emp. Form.C32H26N2O4S
Mol. Mass.534.625
SMILESOC(=O)c1ccc(CN2\C(S\C(=C/c3ccc(OCCc4ccccc4)cc3)C2=O)=N\c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a