Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3)
LigandBDBM50209568
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1286130
IC50 670±n/a nM
Citation Brooke, DGvan Dam, EMWatts, CKKhoury, ADziadek, MABrooks, HGraham, LJFlanagan, JUDenny, WA Targeting the Warburg Effect in cancer; relationships for 2-arylpyridazinones as inhibitors of the key glycolytic enzyme 6-phosphofructo-2-kinase/2,6-bisphosphatase 3 (PFKFB3). Bioorg Med Chem22:1029-39 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3)
Name:6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3)
Synonyms:6-phosphofructo-2-kinase | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 | 6PF-2-K/Fru-2,6-P2ase 3 | 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme | Fructose-2,6-bisphosphatase | PFK/FBPase 3 | PFKFB3 | Renal carcinoma antigen NY-REN-56 | iPFK-2
Type:Enzyme
Mol. Mass.:59620.59
Organism:Homo sapiens (Human)
Description:Q16875
Residue:520
Sequence:
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209568
NameBDBM50209568
Synonyms:4',7,8-trihydroxyisoflavone | 7,8,4'-trihydroxyisoflavone | 7,8-dihydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one | CHEMBL242739 | IR-301
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1coc2c(O)c(O)ccc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a