Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-lysine 6-oxidase
LigandBDBM50446737
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1288378
IC50>1000000±n/a nM
Citation Lucchesini, FPocci, MAlfei, SBertini, VBuffoni, F Synthesis of 2,6-disubstituted benzylamine derivatives as reversible selective inhibitors of copper amine oxidases. Bioorg Med Chem22:1558-67 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-lysine 6-oxidase
Name:Protein-lysine 6-oxidase
Synonyms:LOX
Type:PROTEIN
Mol. Mass.:28737.77
Organism:Sus scrofa
Description:ChEMBL_108023
Residue:246
Sequence:
DDPYNPYKYSDDNPYYNYYERPRPGSRYRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKM
SMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSC
HQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGC
YDTYNADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASG
CTISPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446737
NameBDBM50446737
Synonyms:CHEMBL3114417
TypeSmall organic molecule
Emp. Form.C11H17NO2
Mol. Mass.195.2582
SMILESCOCc1cccc(COC)c1CN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a