Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTG 1019
LigandBDBM50446964
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290942
IC50 136±n/a nM
Citation Gore, VGravel, SCossette, CPatel, PChourey, SYe, QRokach, JPowell, WS Inhibition of 5-oxo-6,8,11,14-eicosatetraenoic acid-induced activation of neutrophils and eosinophils by novel indole OXE receptor antagonists. J Med Chem57:364-77 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TG 1019
Name:TG 1019
Synonyms:5-oxo-ETE G-protein coupled receptor | G-protein coupled receptor 170 | G-protein coupled receptor R527 | G-protein coupled receptor TG1019 | Oxoeicosanoid receptor 1
Type:Enzyme Catalytic Domain
Mol. Mass.:45833.20
Organism:HUMAN
Description:TG 1019 0 HUMAN::Q8TDS5
Residue:423
Sequence:
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH
TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV
VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY
RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV
VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP
NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS
SQG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446964
NameBDBM50446964
Synonyms:CHEMBL3115783
TypeSmall organic molecule
Emp. Form.C21H29NO3
Mol. Mass.343.4599
SMILESCCCCCCc1c(C)c2ccccc2n1C(=O)CC(C)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50446964
Synonyms:CHEMBL3115783
TypeSmall organic molecule
Emp. Form.C21H29NO3
Mol. Mass.343.4599
SMILESCCCCCCc1c(C)c2ccccc2n1C(=O)CC(C)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: