Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target15-Lipoxygenase-2 (15-LOX-2)
LigandBDBM50447178
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290549
IC50>40000±n/a nM
Citation Luci, DKJameson, JBYasgar, ADiaz, GJoshi, NKantz, AMarkham, KPerry, SKuhn, NYeung, JKerns, EHSchultz, LHolinstat, MNadler, JLTaylor-Fishwick, DAJadhav, ASimeonov, AHolman, TRMaloney, DJ Synthesis and structure-activity relationship studies of 4-((2-hydroxy-3-methoxybenzyl)amino)benzenesulfonamide derivatives as potent and selective inhibitors of 12-lipoxygenase. J Med Chem57:495-506 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
15-Lipoxygenase-2 (15-LOX-2)
Name:15-Lipoxygenase-2 (15-LOX-2)
Synonyms:15-LOX-2 | 15-Lipo-oxygenase type 2 (15-LOX-2) | 15-lipoxygenase 2 | Arachidonate 15-lipoxygenase type II | Arachidonate 15-lipoxygenase, type II | Arachidonate 15-lipoxygenase-2 | Epithelial 15-lipoxygenase-2
Type:Protein
Mol. Mass.:75850.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:676
Sequence:
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447178
NameBDBM50447178
Synonyms:CHEMBL1596118
TypeSmall organic molecule
Emp. Form.C17H17N3O4S2
Mol. Mass.391.465
SMILESCOc1cccc(CNc2ccc(cc2)S(=O)(=O)Nc2nccs2)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a