Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucokinase
LigandBDBM50447274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1291068
EC50 455±n/a nM
Citation St Jean, DJAshton, KSBartberger, MDChen, JChmait, SCupples, RGalbreath, EHelmering, JHong, FTJordan, SRLiu, LKunz, RKMichelsen, KNishimura, NPennington, LDPoon, SFReid, DSivits, GStec, MMTadesse, STamayo, NVan, GYang, KCZhang, JNorman, MHFotsch, CLloyd, DJHale, C Small molecule disruptors of the glucokinase-glucokinase regulatory protein interaction: 2. Leveraging structure-based drug design to identify analogues with improved pharmacokinetic profiles. J Med Chem57:325-38 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucokinase
Name:Glucokinase
Synonyms:Gck | Gk | HK IV | HK4 | Hexokinase-4 | Hexokinase-D
Type:Enzyme
Mol. Mass.:52075.40
Organism:Mus musculus (Mouse)
Description:P52792
Residue:465
Sequence:
MLDDRARMEATKKEKVEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDESSVNPGQQLYEKIIGGKYMGE
LVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRRQILNILSTLGLRPS
VADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447274
NameBDBM50447274
Synonyms:CHEMBL3114183
TypeSmall organic molecule
Emp. Form.C21H20F6N4O3S
Mol. Mass.522.464
SMILESCC#CC1CN(CCN1c1ccc(cc1)C(O)(C(F)(F)F)C(F)(F)F)S(=O)(=O)c1ccc(N)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a