Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 3a (5-HT3a)/3b (5-HT3b) receptor
LigandBDBM50455944
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3381
IC50 43±n/a nM
Citation Swain, CJBaker, RKneen, CHerbert, RMoseley, JSaunders, JSeward, EMStevenson, GIBeer, MStanton, J Novel 5-HT3 antagonists: indol-3-ylspiro(azabicycloalkane-3,5'(4'H)-oxazoles). J Med Chem35:1019-31 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
Name:Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
Synonyms:Serotonin 3 (5-HT3) receptor
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 2974
Components:This complex has 2 components.
Component 1
Name:Serotonin (5-HT) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50328.78
Organism:Rattus norvegicus
Description:EBI_11885
Residue:437
Sequence:
MILLWSCLLVAVVGILGTATPQPGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLC
VHAVLDVDVQNQKLKTSMWYREVWNDEFLSWNSSLFDDIQEISLPLSAIWAPDIIINEFV
DVERSPDLPYVYVNSSGTIRNHKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDID
LGFLRNQEDIENDKRSFLNDSEWQLLSVTSTYHIRQSSAGDFAQIRFNVVIRRCPLAYVV
SLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTSLIGV
FFTVCMALLVLSLSKSILLIKFLYEERHSEQERPLMCLRGDSDANESRLYLRAPCAEDTE
SPVRQEHQVPSDTLKDFWFQLQSINNSLRTRDQVYQKEVEWLAILCHFDQLLFRIYLAVL
GLYTVTLCSLWALWSRM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Serotonin (5-HT) receptor
Synonyms:5-HT3 | 5-hydroxytryptamine receptor 3A | Zacopride site-R
Type:Enzyme Catalytic Domain
Mol. Mass.:55428.70
Organism:RAT
Description:5-HT3 HTR3A RAT::P35563
Residue:483
Sequence:
MPLCIPQVLLALFLSVLIAQGEGSRRRATQAHSTTQPALLRLSDHLLANYKKGVRPVRDW
RKPTLVSIDVIMYAILNVDEKNQVLTTYIWYRQFWTDEFLQWTPEDFDNVTKLSIPTDSI
WVPDILINEFVDVGKSPSIPYVYVHHQGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRTPEEVRSDKSIFINQGEWELLGVFTKFQEFSIETSNSYAEMKFY
VVIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTL
PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRHLVLDRIAWLL
CLGEQPMAHRPPATFQANKTDDCSAMGNHCSHVGSPQDLEKTSRSRDSPLPPPREASLAV
RGLLQELSSIRHSLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIW
HYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50455944
NameBDBM50455944
Synonyms:CHEMBL1169544
TypeSmall organic molecule
Emp. Form.C19H24IN3O
Mol. Mass.437.3178
SMILES[I-].Cn1cc(C2=NC[C@@]3(C[N+]4(C)CCC3CC4)O2)c2ccccc12 |r,wU:8.6,wD:8.13,t:4,THB:7:8:13.12:15.16,(9.2,,;-5.8,1.39,;-4.39,.77,;-3.06,1.54,;-1.91,.51,;-.41,.84,;.22,2.25,;1.75,2.09,;2.07,.58,;2.27,-.83,;3.84,-.16,;3.82,-1.7,;5.24,-.81,;4.95,.62,;3.57,1.24,;3.64,2.91,;4.1,1.78,;.74,-.19,;-2.54,-.89,;-1.91,-2.3,;-2.81,-3.55,;-4.34,-3.39,;-4.97,-1.98,;-4.07,-.74,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a