Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAMP deaminase
LigandBDBM50004698
Substrate/Competitorn/a
Meas. Tech.ChEMBL_907756
IC50 100±n/a nM
Citation Lindell, SDMoloney, BAHewitt, BDEarnshaw, CGDudfield, PJDancer, JE The design and synthesis of inhibitors of adenosine 5'-monophosphate deaminase. Bioorg Med Chem Lett9:1985-90 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
AMP deaminase
Name:AMP deaminase
Synonyms:AMPD | AtAMPD | FAC1 | Protein EMBRYONIC FACTOR 1
Type:PROTEIN
Mol. Mass.:95123.85
Organism:Arabidopsis thaliana
Description:ChEMBL_106602
Residue:839
Sequence:
MEPNIYQLALAALFGASFVAVSGFFMHFKALNLVLERGKERKENPDGDEPQNPTLVRRRS
QVRRKVNDQYGRSPASLPDATPFTDGGGGGGGDTGRSNGHVYVDEIPPGLPRLHTPSEGR
ASVHGASSIRKTGSFVRPISPKSPVASASAFESVEESDDDDNLTNSEGLDASYLQANGDN
EMPADANEEQISMAASSMIRSHSVSGDLHGVQPDPIAADILRKEPEQETFVRLNVPLEVP
TSDEVEAYKCLQECLELRKRYVFQETVAPWEKEVISDPSTPKPNTEPFAHYPQGKSDHCF
EMQDGVVHVFANKDAKEDLFPVADATAFFTDLHHVLKVIAAGNIRTLCHRRLVLLEQKFN
LHLMLNADKEFLAQKSAPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKLRKEPDEVVI
FRDGTYLTLREVFESLDLTGYDLNVDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFL
KQDNLIQGRFLGEITKQVFSDLEASKYQMAEYRISIYGRKMSEWDQLASWIVNNDLYSEN
VVWLIQLPRLYNIYKDMGIVTSFQNILDNIFIPLFEATVDPDSHPQLHVFLKQVVGFDLV
DDESKPERRPTKHMPTPAQWTNAFNPAFSYYVYYCYANLYVLNKLRESKGMTTITLRPHS
GEAGDIDHLAATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNP
FPVFFLRGLNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSACDLCEIARNSVYQSGFS
HALKSHWIGKDYYKRGPDGNDIHKTNVPHIRVEFRDTIWKEEMQQVYLGKAVISDEVVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004698
NameBDBM50004698
Synonyms:CHEMBL1160282
TypeSmall organic molecule
Emp. Form.C10H13N4O7P
Mol. Mass.332.2066
SMILESO[C@@H]1[C@@H](COP(O)(O)=O)O[C@H]([C@@H]1O)c1n[nH]c2cncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a