Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEBifunctional epoxide hydrolase 2
LigandBDBM50002351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1338955
IC50 195000±n/a nM
Citation Amano, YYamaguchi, TTanabe, E Structural insights into binding of inhibitors to soluble epoxide hydrolase gained by fragment screening and X-ray crystallography. Bioorg Med Chem22:2427-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EBifunctional epoxide hydrolase 2
Name:EBifunctional epoxide hydrolase 2
Synonyms:Cytosolic epoxide hydrolase 2 | Lipid-phosphate phosphatase | Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002351
NameBDBM50002351
Synonyms:CHEMBL3233608
TypeSmall organic molecule
Emp. Form.C14H19N3OS
Mol. Mass.277.385
SMILESCc1cc(c(C)n1CC1CCCO1)-c1csc(N)n1
Structure
n/a