Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlyl endopeptidase
LigandBDBM50003020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1335101
IC50>67000±n/a nM
Citation Biftu, TSinha-Roy, RChen, PQian, XFeng, DKuethe, JTScapin, GGao, YDYan, YKrueger, DBak, AEiermann, GHe, JCox, JHicks, JLyons, KHe, HSalituro, GTong, SPatel, SDoss, GPetrov, AWu, JXu, SSSewall, CZhang, XZhang, BThornberry, NAWeber, AE Omarigliptin (MK-3102): a novel long-acting DPP-4 inhibitor for once-weekly treatment of type 2 diabetes. J Med Chem57:3205-12 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prolyl endopeptidase
Name:Prolyl endopeptidase
Synonyms:PE | PEP | POP | PREP | Post-proline cleaving enzyme | Prolyl oligopeptidase
Type:Enzyme
Mol. Mass.:80688.50
Organism:Homo sapiens (Human)
Description:P48147
Residue:710
Sequence:
MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003020
NameBDBM50003020
Synonyms:MK-3102 | OMARIGLIPTIN | US10155775, Omarigliptin
TypeSmall organic molecule
Emp. Form.C17H20F2N4O3S
Mol. Mass.398.428
SMILESCS(=O)(=O)n1cc2CN(Cc2n1)[C@H]1CO[C@@H]([C@@H](N)C1)c1cc(F)ccc1F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a