Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase IV
LigandBDBM50003020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1335112
IC50 44±n/a nM
Citation Biftu, TSinha-Roy, RChen, PQian, XFeng, DKuethe, JTScapin, GGao, YDYan, YKrueger, DBak, AEiermann, GHe, JCox, JHicks, JLyons, KHe, HSalituro, GTong, SPatel, SDoss, GPetrov, AWu, JXu, SSSewall, CZhang, XZhang, BThornberry, NAWeber, AE Omarigliptin (MK-3102): a novel long-acting DPP-4 inhibitor for once-weekly treatment of type 2 diabetes. J Med Chem57:3205-12 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dipeptidyl peptidase IV
Name:Dipeptidyl peptidase IV
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:87433.73
Organism:Mus musculus
Description:ChEMBL_1335112
Residue:760
Sequence:
MKTPWKVLLGLLGVAALVTIITVPIVLLSKDEAAADSRRTYSLADYLKSTFRVKSYSLWW
VSDFEYLYKQENNILLLNAEHGNSSIFLENSTFESFGYHSVSPDRLFVLLEYNYVKQWRH
SYTASYNIYDVNKRQLITEEKIPNNTQWITWSPEGHKLAYVWKNDIYVKVEPHLPSHRIT
STGEENVIYNGITDWVYEEEVFGAYSALWWSPNNTFLAYAQFNDTGVPLIEYSFYSDESL
QYPKTVWIPYPKAGAVNPTVKFFIVNIDSLSSSSSAAPIQIPAPASVARGDHYLCDVVWA
TEERISLQWLRRIQNYSVMAICDYDKINLTWNCPSEQQHVEMSTTGWVGRFRPAEPHFTS
DGSSFYKIISDKDGYKHICHFPKDKKDCTFITKGAWEVISIEALTSDYLYYISNQYKEMP
GGRNLYKIQLTDHTNVKCLSCDLNPERCQYYAVSFSKEAKYYQLGCWGPGLPLYTLHRST
DHKELRVLEDNSALDRMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKKYPLLLDV
YAGPCSQKADASFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTLEVEDQ
IEAARQFVKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVY
TERYMGLPIPEDNLDHYRNSTVMSRAEHFKQVEYLLIHGTADDNVHFQQSAQISKALVDA
GVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003020
NameBDBM50003020
Synonyms:MK-3102 | OMARIGLIPTIN | US10155775, Omarigliptin
TypeSmall organic molecule
Emp. Form.C17H20F2N4O3S
Mol. Mass.398.428
SMILESCS(=O)(=O)n1cc2CN(Cc2n1)[C@H]1CO[C@@H]([C@@H](N)C1)c1cc(F)ccc1F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a