Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinic acetylcholine receptor alpha2/beta2
LigandBDBM50006616
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1335284
Ki>10000±n/a nM
Citation Gao, YKellar, KJYasuda, RPTran, TXiao, YDannals, RFHorti, AG Derivatives of dibenzothiophene for positron emission tomography imaging ofa7-nicotinic acetylcholine receptors. J Med Chem56:7574-89 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinic acetylcholine receptor alpha2/beta2
Name:Nicotinic acetylcholine receptor alpha2/beta2
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 964980
Components:This complex has 2 components.
Component 1
Name:alpha-1 Nicotinic AChR
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Nicotinic acetylcholine receptor alpha3/beta2/alpha5
Synonyms:Neuronal acetylcholine receptor protein beta-2 subunit | Neuronal acetylcholine receptor subunit beta-2 | Nicotinic acetylcholine receptor alpha3/beta2/alpha5
Type:Protein
Mol. Mass.:57020.50
Organism:Homo sapiens (Human)
Description:P17787
Residue:502
Sequence:
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006616
NameBDBM50006616
Synonyms:CHEMBL3235484
TypeSmall organic molecule
Emp. Form.C19H19FN2O2S
Mol. Mass.358.43
SMILESFc1ccc(N2CCN3CCC2CC3)c2-c3ccccc3S(=O)(=O)c12 |(8.37,-3.33,;8.37,-4.88,;9.72,-5.65,;9.71,-7.19,;8.37,-7.96,;8.37,-9.51,;7.02,-10.23,;6.74,-11.75,;7.75,-12.9,;9.3,-12.84,;10.2,-11.6,;9.8,-10.12,;9.26,-11.29,;7.57,-11.26,;7.04,-7.19,;5.58,-7.67,;4.95,-9.07,;3.42,-9.24,;2.51,-8,;3.14,-6.59,;4.68,-6.43,;5.58,-5.18,;5.9,-3.67,;4.43,-4.15,;7.05,-5.65,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a