Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM50008748
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1336776
IC50 0.800000±n/a nM
Citation Gonzalez, AZLi, ZBeck, HPCanon, JChen, AChow, DDuquette, JEksterowicz, JFox, BMFu, JHuang, XHouze, JJin, LLi, YLing, YLo, MCLong, AMMcGee, LRMcIntosh, JOliner, JDOsgood, TRew, YSaiki, AYShaffer, PWortman, SYakowec, PYan, XYe, QYu, DZhao, XZhou, JOlson, SHSun, DMedina, JC Novel inhibitors of the MDM2-p53 interaction featuring hydrogen bond acceptors as carboxylic acid isosteres. J Med Chem57:2963-88 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50008748
NameBDBM50008748
Synonyms:CHEMBL3236357
TypeSmall organic molecule
Emp. Form.C33H37Cl2FN2O5S2
Mol. Mass.695.692
SMILESCC(C)(C)S(=O)(=O)C[C@H](C1CC1)N1[C@@H]([C@H](C[C@](C)(Cc2ncc(CC(O)=O)s2)C1=O)c1cccc(Cl)c1)c1ccc(Cl)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a