Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCD44 antigen
LigandBDBM13016
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1337580
Kd 11200000±n/a nM
Citation Liu, LKFinzel, BC Fragment-based identification of an inducible binding site on cell surface receptor CD44 for the design of protein-carbohydrate interaction inhibitors. J Med Chem57:2714-25 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CD44 antigen
Name:CD44 antigen
Synonyms:CD_antigen=CD44 | Cd44 | ECMR-III | Extracellular matrix receptor III | GP90 lymphocyte homing/adhesion receptor | HUTCH-I | Hermes antigen | Hyaluronate receptor | Ly-24
Type:PROTEIN
Mol. Mass.:85579.86
Organism:Mus musculus
Description:ChEMBL_108281
Residue:778
Sequence:
MDKFWWHTAWGLCLLQLSLAHQQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNS
TLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTY
CFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDD
VSSGSTIEKSTPEGYILHTYLPTEQPTGDQDDSFFIRSTLATIASTVHSKSHAAAQKQNN
WIWSWFGNSQSTTQTQEPTTSATTALMTTPETPPKRQEAQNWFSWLFQPSESKSHLHTTT
KMPGTESNTNPTGWEPNEENEDETDTYPSFSGSGIDDDEDFISSTIATTPRVSARTEDNQ
DWTQWKPNHSNPEVLLQTTTRMADIDRISTSAHGENWTPEPQPPFNNHEYQDEEETPHAT
STTPNSTAEAAATQQETWFQNGWQGKNPPTPSEDSHVTEGTTASAHNNHPSQRITTQSQE
DVSWTDFFDPISHPMGQGHQTESKDTDSSHSTTLQPTAAPNTHLVEDLNRTGPLSVTTPQ
SHSQNFSTLHGEPEEDENYPTTSILPSSTKSSAKDARRGGSLPTDTTTSVEGYTFQYPDT
MENGTLFPVTPAKTEVFGETEVTLATDSNVNVDGSLPGDRDSSKDSRGSSRTVTHGSELA
GHSSANQDSGVTTTSGPMRRPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVI
NGGNGTVEDRKPSELNGEASKSQEMVHLVNKEPSETPDQCMTADETRNLQSVDMKIGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13016
NameBDBM13016
Synonyms:1,2,3,4-tetrahydroisoquinoline | CHEMBL14346 | THIQ 6 | tetrahydroisoquinoline
TypeSmall organic molecule
Emp. Form.C9H11N
Mol. Mass.133.1903
SMILESC1Cc2ccccc2CN1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a