BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUracil nucleotide/cysteinyl leukotriene receptor
LigandBDBM50004952
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1353471
Ki 1210±n/a nM
Citation  n/a ACS Med Chem Lett5:326-330 (2014)    Article
More Info.:Get all data from this article,  Assay Method
 
Uracil nucleotide/cysteinyl leukotriene receptor
Name:Uracil nucleotide/cysteinyl leukotriene receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41013.71
Organism:Homo sapiens
Description:ChEMBL_1353471
Residue:367
Sequence:
MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENM
LFASFYLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHF
SGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLAC
AFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCY
LLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQ
RILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESS
LSAKSEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004952
NameBDBM50004952
Synonyms:3-(2-Carboxy-ethyl)-4,6-dichloro-1H-indole-2-carboxylic acid | CHEMBL31344
TypeSmall organic molecule
Emp. Form.C12H9Cl2NO4
Mol. Mass.302.11
SMILESOC(=O)CCc1c([nH]c2cc(Cl)cc(Cl)c12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a