Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target15-Lipoxygenase-2 (15-LOX-2)
LigandBDBM50011735
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1352304
IC50>50000±n/a nM
Citation Rai, GJoshi, NJung, JELiu, YSchultz, LYasgar, APerry, SDiaz, GZhang, QKenyon, VJadhav, ASimeonov, ALo, EHvan Leyen, KMaloney, DJHolman, TR Potent and selective inhibitors of human reticulocyte 12/15-lipoxygenase as anti-stroke therapies. J Med Chem57:4035-48 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
15-Lipoxygenase-2 (15-LOX-2)
Name:15-Lipoxygenase-2 (15-LOX-2)
Synonyms:15-LOX-2 | 15-Lipo-oxygenase type 2 (15-LOX-2) | 15-lipoxygenase 2 | Arachidonate 15-lipoxygenase type II | Arachidonate 15-lipoxygenase, type II | Arachidonate 15-lipoxygenase-2 | Epithelial 15-lipoxygenase-2
Type:Protein
Mol. Mass.:75850.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:676
Sequence:
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011735
NameBDBM50011735
Synonyms:CHEMBL3262908
TypeSmall organic molecule
Emp. Form.C11H7Cl2N3O
Mol. Mass.268.099
SMILESCNc1oc(nc1C#N)-c1cccc(Cl)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a