Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform alpha
LigandBDBM50016163
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1350182
IC50 694±n/a nM
Citation Reichelt, ABailis, JMBartberger, MDYao, GShu, HKaller, MRAllen, JGWeidner, MFKeegan, KSDao, JH Synthesis and structure-activity relationship of trisubstituted thiazoles as Cdc7 kinase inhibitors. Eur J Med Chem80:364-82 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform alpha
Name:Casein kinase I isoform alpha
Synonyms:CK1 | CKI-alpha | CSNK1A1 | Casein Kinase I | Casein kinase 1 alpha (CK1 alpha)
Type:Serine/threonine-protein kinase
Mol. Mass.:38936.59
Organism:Homo sapiens (Human)
Description:P48729
Residue:337
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016163
NameBDBM50016163
Synonyms:CHEMBL3261514
TypeSmall organic molecule
Emp. Form.C14H9Cl2N5OS
Mol. Mass.366.225
SMILESNC(=O)c1sc(nc1-c1ccc(Cl)cc1Cl)-c1ccnc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a