Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProheparin-binding EGF-like growth factor
LigandBDBM50017346
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1363175
Kd 25000000±n/a nM
Citation Roy, SEl Hadri, ARichard, SDenis, FHolte, KDuffner, JYu, FGalcheva-Gargova, ZCapila, ISchultes, BPetitou, MKaundinya, GV Synthesis and biological evaluation of a unique heparin mimetic hexasaccharide for structure-activity relationship studies. J Med Chem57:4511-20 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proheparin-binding EGF-like growth factor
Name:Proheparin-binding EGF-like growth factor
Synonyms:DT-R | DTR | DTS | Diphtheria toxin receptor | HB-EGF | HBEGF
Type:PROTEIN
Mol. Mass.:23082.84
Organism:Homo sapiens (Human)
Description:ChEMBL_108372
Residue:208
Sequence:
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017346
NameBDBM50017346
Synonyms:CHEMBL3288258
TypeSmall organic molecule
Emp. Form.C47H66N3Na9O52S6
Mol. Mass.1904.314
SMILES[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[H][C@]1(O[C@@H]2O[C@@H](C([O-])=O)[C@@]([H])(O[C@H]3O[C@H](COS([O-])(=O)=O)[C@@]([H])(O[C@@H]4O[C@@H](C([O-])=O)[C@@]([H])(O[C@H]5O[C@H](COS([O-])(=O)=O)[C@@]([H])(O[C@@H]6O[C@H]([C@@H](O)[C@H](O)[C@H]6OS([O-])(=O)=O)C([O-])=O)[C@H](O)[C@H]5NC(C)=O)[C@H](O)[C@H]4OS([O-])(=O)=O)[C@H](O)[C@H]3NC(C)=O)[C@H](O)[C@H]2OS([O-])(=O)=O)[C@H](O)[C@@H](NC(C)=O)[C@@H](OCCCCC)O[C@@H]1COS([O-])(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a