Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRAS guanyl-releasing protein 1
LigandBDBM50017892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1364410
Ki 0.690000±n/a nM
Citation Garcia, LCDonadío, LGMann, EKolusheva, SKedei, NLewin, NEHill, CSKelsey, JSYang, JEsch, TESantos, MPeach, MLKelley, JABlumberg, PMJelinek, RMarquez, VEComin, MJ Synthesis, biological, and biophysical studies of DAG-indololactones designed as selective activators of RasGRP. Bioorg Med Chem22:3123-40 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RAS guanyl-releasing protein 1
Name:RAS guanyl-releasing protein 1
Synonyms:CalDAG-GEFII | Calcium and DAG-regulated guanine nucleotide exchange factor II | RASGRP | RASGRP1 | Ras guanyl-releasing protein
Type:PROTEIN
Mol. Mass.:90418.98
Organism:Homo sapiens (Human)
Description:ChEMBL_102739
Residue:797
Sequence:
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017892
NameBDBM50017892
Synonyms:CHEMBL3289014
TypeSmall organic molecule
Emp. Form.C24H31NO5
Mol. Mass.413.5066
SMILESCCCC(CCC)C(=O)OCC1(CO)C\C(=C/c2cccc3ccn(C)c23)C(=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a