Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM86757
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1438097
EC50 0.100000±n/a nM
Citation Kumar, JSMajo, VJPrabhakaran, JMann, JJ Synthesis and evaluation of arylpiperazines derivatives of 3,5-dioxo-(2H,4H)-1,2,4-triazine as 5-HT1AR ligands. Bioorg Med Chem Lett24:4759-62 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86757
NameBDBM86757
Synonyms:CAS_0 | NSC_11603174 | [11C]MMP
TypeSmall organic molecule
Emp. Form.C19H27N5O3
Mol. Mass.373.4494
SMILESCOc1ccccc1N1CCN(CCCCn2ncc(=O)n(C)c2=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a