Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50030759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437734
Ki<0.010000±n/a nM
Citation Tao, ZFHasvold, LWang, LWang, XPetros, AMPark, CHBoghaert, ERCatron, NDChen, JColman, PMCzabotar, PEDeshayes, KFairbrother, WJFlygare, JAHymowitz, SGJin, SJudge, RAKoehler, MFKovar, PJLessene, GMitten, MJNdubaku, CONimmer, PPurkey, HEOleksijew, APhillips, DCSleebs, BESmith, BJSmith, MLTahir, SKWatson, KGXiao, YXue, JZhang, HZobel, KRosenberg, SHTse, CLeverson, JDElmore, SWSouers, AJ Discovery of a Potent and Selective BCL-XL Inhibitor with in Vivo Activity. ACS Med Chem Lett5:1088-93 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030759
NameBDBM50030759
Synonyms:CHEMBL3342194
TypeSmall organic molecule
Emp. Form.C33H28N6O4S2
Mol. Mass.636.743
SMILESOC(=O)c1nc(sc1CCCOc1ccc(cc1)-n1cccn1)N1CCc2cccc(C(=O)Nc3nc4ccccc4s3)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a