Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTubulin
LigandBDBM50030765
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437750
Kd 1000±n/a nM
Citation Hayashi, YTakeno, HChinen, TMuguruma, KOkuyama, KTaguchi, ATakayama, KYakushiji, FMiura, MUsui, THayashi, Y Development of a new benzophenone-diketopiperazine-type potent antimicrotubule agent possessing a 2-pyridine structure. ACS Med Chem Lett5:1094-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tubulin
Name:Tubulin
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 1437750
Components:This complex has 2 components.
Component 1
Name:Tubulin
Synonyms:Tubulin alpha chain | Tubulin alpha-1A chain
Type:Protein
Mol. Mass.:50049.25
Organism:Sus scrofa (Pig)
Description:P02550
Residue:451
Sequence:
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Tubulin beta chain
Synonyms:Beta-tubulin | Tubulin beta chain
Type:PROTEIN
Mol. Mass.:49840.26
Organism:Sus scrofa
Description:ChEMBL_105107
Residue:445
Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEGEEDEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030765
NameBDBM50030765
Synonyms:NPI-2358 | PLINABULIN | Plinabulin
TypeSmall organic molecule
Emp. Form.C19H20N4O2
Mol. Mass.336.3877
SMILESCC(C)(C)c1[nH]cnc1\C=c1/[nH]c(=O)\c(=C\c2ccccc2)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a