Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50031448
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437145
Ki 4.0±n/a nM
Citation Brindisi, MButini, SFranceschini, SBrogi, STrotta, FRos, SCagnotto, ASalmona, MCasagni, AAndreassi, MSaponara, SGorelli, BWeikop, PMikkelsen, JDScheel-Kruger, JSandager-Nielsen, KNovellino, ECampiani, GGemma, S Targeting dopamine D3 and serotonin 5-HT1A and 5-HT2A receptors for developing effective antipsychotics: synthesis, biological characterization, and behavioral studies. J Med Chem57:9578-97 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031448
NameBDBM50031448
Synonyms:CHEMBL3358494
TypeSmall organic molecule
Emp. Form.C23H27N3O2
Mol. Mass.377.4794
SMILESO=C(NCCCCN1CCN(CC1)c1ccccc1)c1cc2ccccc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a