Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBacterial dihydropteroate synthase
LigandBDBM50031529
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1440910
Kd 43900±n/a nM
Citation Dennis, MLChhabra, SWang, ZCDebono, ADolezal, ONewman, JPitcher, NPRahmani, RCleary, BBarlow, NHattarki, MGraham, BPeat, TSBaell, JBSwarbrick, JD Structure-based design and development of functionalized Mercaptoguanine derivatives as inhibitors of the folate biosynthesis pathway enzyme 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from Staphylococcus aureus. J Med Chem57:9612-26 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bacterial dihydropteroate synthase
Name:Bacterial dihydropteroate synthase
Synonyms:Dihydropteroate synthase
Type:PROTEIN
Mol. Mass.:30611.24
Organism:Escherichia coli (strain K12)
Description:ChEMBL_1440910
Residue:282
Sequence:
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031529
NameBDBM50031529
Synonyms:CHEMBL3359161
TypeSmall organic molecule
Emp. Form.C12H11N5OS
Mol. Mass.273.314
SMILESNc1nc2[nH]c(SCc3ccccc3)nc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a