Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIV
LigandBDBM50031587
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441646
Kd 4300±n/a nM
Citation Dudutiene, VMatuliene, JSmirnov, ATimm, DDZubriene, ABaranauskiene, LMorkunaite, VSmirnoviene, JMichailoviene, VJuozapaitiene, VMickeviciute, AKazokaite, JBak?yte, SKasiliauskaite, AJachno, JRevuckiene, JKi?onaite, MPilipuityte, VIvanauskaite, EMilinaviciute, GSmirnovas, VPetrikaite, VKairys, VPetrauskas, VNorvai?as, PLinge, DGibie?a, PCapkauskaite, EZak?auskas, AKazlauskas, EManakova, EGra?ulis, SLadbury, JEMatulis, D Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX. J Med Chem57:9435-46 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIV
Name:Carbonic Anhydrase XIV
Synonyms:CA-XIV | Carbonate dehydratase XIV | Carbonic anhydrase 14 | Carbonic anhydrase 14 (CA XIV) | Carbonic anhydrase XIV (CA XIV)
Type:Enzyme
Mol. Mass.:37665.67
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme.
Residue:337
Sequence:
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031587
NameBDBM50031587
Synonyms:CHEMBL3359180
TypeSmall organic molecule
Emp. Form.C26H35F3N2O2S2
Mol. Mass.528.694
SMILESNS(=O)(=O)c1c(F)c(F)c(SCCc2ccccc2)c(F)c1NC1CCCCCCCCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a